PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018764-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 310aa    MW: 34822 Da    PI: 6.9901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018764-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed +l ++vk +G g W+  +r+ g+ R++k+c++rw++yl
    NNU_018764-RA 14 RGAWSALEDRILSNYVKAHGEGKWRDLPRRAGLSRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding55.11.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +t+E+el+++++++lG++ W++Ia +++ gRt++++k++w++yl
    NNU_018764-RA  67 RGNISTDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 112
                      7899******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.933961IPR017930Myb domain
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
SuperFamilySSF466892.11E-2713108IPR009057Homeodomain-like
PfamPF002496.4E-131461IPR001005SANT/Myb domain
CDDcd001673.97E-81661No hitNo description
PROSITE profilePS5129425.79462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2465115IPR009057Homeodomain-like
SMARTSM007174.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.50E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRRPCCAKE MVKRGAWSAL EDRILSNYVK AHGEGKWRDL PRRAGLSRCG KSCRLRWLNY  60
LRPGIKRGNI STDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT YLSKKSQDKT  120
PQKGFNHPDK EKKPVRKSTV EVPKAANCST AIRTKARRST TQVVLPEEDG KEGHQSIKTT  180
DQSTAASDGG IIGENLSSSA GQGDDCSDFL KDFDSSELFM SDFLGQADLL QVHGEGIKEN  240
NNLIDKDMVE NNSSTFSAYN NLLSSDDVIL EDSSYAAILE SWLDCDSLQP NEDLEINRLA  300
CPLDLKEERK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-221411527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274708.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0G3Y2633e-81A0A0G3Y263_DAVIN; Anthocyanin regulatory C1 protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.16e-50myb domain protein 12